Ordering from the Americas?Switch to the US store
We don't ship to your country yet. We ship across Europe and the Americas. You can keep browsing.
Account

Peptency Academy · Compound

Retatrutide (LY3437943)

Retatrutide (development code LY3437943) is an investigational 39 residue lipidated peptide studied as an agonist at three receptors: GIP, GLP-1 and glucagon. Source sentenceAbstract, Background: "Retatrutide is an agonist of GIP, GLP-1, and glucagon receptors, and is currently under investigation ..."; GSRS: LY3437943 code and a 39 residue sequence1 Lancet 2026, TRIUMPH-22 GSRS substance record, UNII NOP2Y096GV PubChem lists it under CID 171390338: formula C221H342N46O68, about 4731 Da. Source sentencePUG REST property table, CID 171390338: MolecularFormula C221H342N46O68; MW 4731; MonoisotopicMass 4728.4717592; ExactMass 4730.4784689; InChIKey MLOLQJNKXBNWFW-SAGGEDDASA-N. Substance records named retatrutide (for example SID 438519203) map to CID 1713903383 PubChem CID 171390338 As of Eli Lilly and Company's statement of 12 Aug 2026, no medicine containing retatrutide had been approved by any regulatory agency. Source sentenceRetatrutide is an investigational molecule in Phase 3 clinical trials ... No medicine containing retatrutide has yet been approved for human use by any regulatory agency in the world.4 Eli Lilly and Company news release, 12 August 2026

Version 1Edited Evidence through 48 sources

Regulatory content shown for: EU and UK.

Peptide, investigational

  • Catalog recordRetatrutide39 residuesabout 4731 DaSource sentencePUG REST property table, CID 171390338: MolecularFormula C221H342N46O68; MW 4731; MonoisotopicMass 4728.4717592; ExactMass 4730.4784689; InChIKey MLOLQJNKXBNWFW-SAGGEDDASA-N. Substance records named retatrutide (for example SID 438519203) map to CID 1713903383 PubChem CID 171390338

Known, not known, contested

Known

  • Retatrutide is one peptide chain: Lys17 carries a C20 fatty diacid through a gamma-glutamyl and aminoethoxy ethoxy acetyl linker, positions 2 and 20 are 2-methylalanine, position 13 is 2-methyl-L-leucine, and the C-terminus is an amide. Source sentenceSystematic name: L-Tyrosyl-2-methylalanyl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-2-methyl-L-leucyl-L-leucyl-L-α-aspartyl-L-lysyl-N6-[N-(19-carboxy-1-oxononadecyl)-L-γ-glutamyl-2-[2-(2-aminoethoxy)ethoxy]acetyl]-L-lysyl-L-alanyl-L-glutaminyl-2-methylalanyl-L-alanyl-L-phenylalanyl ... -L-prolyl-L-prolyl-L-prolyl-L-serinamide2 GSRS substance record, UNII NOP2Y096GV
  • A 2022 discovery paper describes LY3437943 as an agonist at the glucagon, GIP and GLP-1 receptors and measured its activity at each of the three receptors in vitro. Source sentenceAbstract: "LY3437943 is a novel triple agonist peptide at the glucagon receptor (GCGR), glucose-dependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R)." The abstract then reports in vitro activity at GCGR, GLP-1R and GIPR5 Cell Metab 2022
  • A PubMed search on 14 Oct 2026 found 201 records for retatrutide or LY3437943: 119 are tagged as reviews and 9 as randomised controlled trials. Source sentencebase query: 201 records; AND review[pt]: 119; AND randomized controlled trial[pt]: 9 (42810372, 42608321, 42250575, 40916752, 40609566, 38858523, 37385280, 37366315, 36354040)6 PubMed search for retatrutide and LY3437943, 14 October 2026
  • ClinicalTrials.gov listed 33 records for retatrutide on 14 Oct 2026, 14 of them phase 3 studies; Eli Lilly and Company is lead sponsor of 32. Source sentencequery.intr retatrutide: totalCount 33; phases PHASE1 14, PHASE2 4, PHASE3 14, one expanded access record (status AVAILABLE, no phase); phase 3 overall status COMPLETED 5, ACTIVE_NOT_RECRUITING 8, RECRUITING 1; lead sponsor Eli Lilly and Company 32, Hudson Biotech 17 ClinicalTrials.gov search, 14 October 2026
  • Three phase 3 trials have journal papers with results (PMID 42814954, 42810372 and 42250575). Source sentenceAbstracts of PMID 42814954 (Results), 42810372 (Findings) and 42250575 (Findings): primary endpoints met against placebo8 N Engl J Med 2026, TRIUMPH-11 Lancet 2026, TRIUMPH-29 Lancet 2026, NCT06354660

Not known

  • Two completed phase 3 trials, TRIUMPH-3 (NCT05882045) and TRIUMPH-4 (NCT05931367), had no results posted on ClinicalTrials.gov and no journal paper in PubMed as of 14 Oct 2026. Source sentenceNCT05882045: overall status COMPLETED (14 May 2026), hasResults false; NCT05931367: COMPLETED (14 Nov 2025), hasResults false; PubMed searches for NCT05882045 and NCT05931367: 0 records each10 NCT0588204511 NCT059313676 PubMed search for retatrutide and LY3437943, 14 October 2026
  • No phase 3 result comparing retatrutide with tirzepatide was published as of 14 Oct 2026: TRIUMPH-5 (NCT06662383) is active, not recruiting, with primary completion estimated for Nov 2026. Source sentenceNCT06662383: interventions Retatrutide and Tirzepatide; overall status ACTIVE_NOT_RECRUITING; primary completion 2026-11 (ESTIMATED); hasResults false12 NCT06662383
  • No result of the cardiovascular and kidney events trial (NCT06383390) exists yet: its completion is estimated for Feb 2029. Source sentenceNCT06383390: overall status ACTIVE_NOT_RECRUITING; primary outcome "Time to First Occurrence of Composite Endpoints"; completion 2029-02 (ESTIMATED)13 NCT06383390

Contested

  • What products sold as retatrutide outside trials contain is not settled by the small analyses published as of 14 Oct 2026: a 2026 letter found retatrutide in all three products it tested, while a TGA laboratory test found semaglutide and no retatrutide in one product. Source sentencePMC13445994, Discussion: "all samples contained the expected peptide"; TGA advisory, 14 Sep 2026: "the product contained undeclared semaglutide and no retatrutide"14 Drug Alcohol Rev 202615 PMC full text of the 2026 letter (PMID 42559975)16 TGA safety advisory, 14 September 2026
  • Mass values for retatrutide differ by how they are computed: PubChem lists a monoisotopic mass of 4728.4718 Da, an exact mass of 4730.4785 Da and an average mass of 4731 Da, and a 2026 letter gives 4730.477 Da as the expected value for authentic retatrutide. Source sentencePubChem: MonoisotopicMass 4728.4717592; ExactMass 4730.4784689; MW 4731. PMC13445994, Results: "closely matching the expected ... of authentic retatrutide (4730.477 Da)"3 PubChem CID 17139033814 Drug Alcohol Rev 202615 PMC full text of the 2026 letter (PMID 42559975)

Chemistry: retatrutide as PubChem CID 171390338 records it

Sequence
YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS
Length
39 residues
Modifications
2-methylalanine (Aib) at positions 2 and 20, 2-methyl-L-leucine at position 13, Lys17 acylated with a C20 fatty diacid through a gamma-glutamyl and aminoethoxy ethoxy acetyl linker, C-terminal amide
Formula
C221H342N46O68
Monoisotopic mass
4728.4718 Da
Average mass
4731 Da
CAS
2381089-83-2
PubChem CID
171390338
InChIKey
MLOLQJNKXBNWFW-SAGGEDDASA-N
Synonyms
LY3437943, LY-3437943
Salt form
sodium
Checked 14 October 2026 3 PubChem CID 171390338

Chemistry: identifiers and salt form

  • The Global Substance Registration System records retatrutide under UNII NOP2Y096GV with CAS 2381089-83-2, INN and USAN entries for the name retatrutide, and the development code LY3437943. Source sentenceNames: Retatrutide [INN], RETATRUTIDE [USAN], LY3437943; codes: CAS 2381089-83-2 (PRIMARY), UNII NOP2Y096GV; protein subunit sequence YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS (39 residues); relationships: GLUCAGON-LIKE PEPTIDE 1 RECEPTOR, GASTRIC INHIBITORY POLYPEPTIDE RECEPTOR and GLUCAGON RECEPTOR, each TARGET->AGONIST2 GSRS substance record, UNII NOP2Y096GV
  • PubChem substance records named retatrutide (for example SID 438519203) map to compound CID 171390338, InChIKey MLOLQJNKXBNWFW-SAGGEDDASA-N. Source sentencePUG REST property table, CID 171390338: MolecularFormula C221H342N46O68; MW 4731; MonoisotopicMass 4728.4717592; ExactMass 4730.4784689; InChIKey MLOLQJNKXBNWFW-SAGGEDDASA-N. Substance records named retatrutide (for example SID 438519203) map to CID 1713903383 PubChem CID 171390338
  • GSRS holds a separate record for retatrutide sodium (UNII LQ42M82ZU6), a salt form; the masses on this page are for the peptide without a counterion. Source sentenceroot_names_name RETATRUTIDE: total 2; Retatrutide NOP2Y096GV (protein); Retatrutide sodium LQ42M82ZU6 (protein); relationship SALT/SOLVATE->PARENT18 GSRS name search for retatrutide, 14 October 2026

Sequence

YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS

K residues 17 to 17One letter sequence as the GSRS record gives it. Lys17 carries the C20 fatty diacid side chain; positions 2, 13 and 20 are non-standard residues written here with their nearest one letter codes.
  • The one letter sequence shows the 39 positions; the full name adds what one letter codes cannot: 2-methylalanine at positions 2 and 20, 2-methyl-L-leucine at position 13, the acylated Lys17 side chain and the C-terminal serinamide. Source sentenceSystematic name: L-Tyrosyl-2-methylalanyl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-2-methyl-L-leucyl-L-leucyl-L-α-aspartyl-L-lysyl-N6-[N-(19-carboxy-1-oxononadecyl)-L-γ-glutamyl-2-[2-(2-aminoethoxy)ethoxy]acetyl]-L-lysyl-L-alanyl-L-glutaminyl-2-methylalanyl-L-alanyl-L-phenylalanyl ... -L-prolyl-L-prolyl-L-prolyl-L-serinamide2 GSRS substance record, UNII NOP2Y096GV

Which molecule does a certificate for retatrutide describe?

  • Read the formula and mass on the certificate of analysis: C221H342N46O68 at about 4731 Da (average) fits retatrutide as PubChem records it (CID 171390338). Semaglutide, PubChem CID 56843331, is C187H291N45O59 at about 4114 Da. Source sentenceCID 171390338: MolecularFormula C221H342N46O68, MW 4731; CID 56843331 (title Semaglutide): MolecularFormula C187H291N45O59, MW 41143 PubChem CID 17139033819 PubChem CID 56843331
  • Mass values for retatrutide differ by how they are computed: PubChem lists a monoisotopic mass of 4728.4718 Da, an exact mass of 4730.4785 Da and an average mass of 4731 Da, and a 2026 letter gives 4730.477 Da as the expected value for authentic retatrutide. Source sentencePubChem: MonoisotopicMass 4728.4717592; ExactMass 4730.4784689; MW 4731. PMC13445994, Results: "closely matching the expected ... of authentic retatrutide (4730.477 Da)"3 PubChem CID 17139033814 Drug Alcohol Rev 202615 PMC full text of the 2026 letter (PMID 42559975)
  • A TGA laboratory test published on 14 Sep 2026 found undeclared semaglutide and no retatrutide in one product sold as retatrutide, obtained in its original unmarked vial. Source sentence"During its investigation, the TGA obtained a sample of the product contained in its original unmarked vial. TGA laboratory testing of the product found that: the product contained undeclared semaglutide and no retatrutide." Published 14 September 202616 TGA safety advisory, 14 September 2026
  • A 2026 letter reports that an accredited laboratory found retatrutide in all three products sold as retatrutide that it tested; identity was checked by molecular mass and peptide content was measured separately. Source sentencePMC13445994, Methods: "Samples were analysed by an independent National Association of Testing Authorities-accredited laboratory. Peptide identity was confirmed using ... analysis. Peptide content was quantified"; Results: "The three samples contained retatrutide"14 Drug Alcohol Rev 202615 PMC full text of the 2026 letter (PMID 42559975)
  • A 2026 LC-HRMS method validated against WADA criteria detects intact retatrutide through its [M+3H]3+ precursor ion, with confirmation from fragment ions. Source sentenceAbstract, Methods: "developed and validated in human plasma and urine in accordance with World Anti-Doping Agency (WADA) criteria. Detection was based on the [M + 3H]3+ precursor ion by targeted selected-ion monitoring (t-SIM), with confirmatory analysis via parallel reaction monitoring (PRM) of structurally diagnostic fragment ions."20 Rapid Commun Mass Spectrom 2026

What is retatrutide?

Retatrutide is a single peptide of 39 residues, developed by Eli Lilly and Company under the code LY3437943, that papers describe as an agonist at the glucagon, GIP and GLP-1 receptors. PubChem records it under CID 171390338 (C221H342N46O68, about 4731 Da), and its CAS number is 2381089-83-2. Source sentenceAbstract: "LY3437943 is a novel triple agonist peptide at the glucagon receptor (GCGR), glucose-dependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R)." Affiliation: Eli Lilly and Company, Indianapolis5 Cell Metab 20222 GSRS substance record, UNII NOP2Y096GV3 PubChem CID 171390338

Is retatrutide "GLP-3"?

Not in the scientific record. A PubMed search on 14 Oct 2026 found no record that pairs "GLP-3" with retatrutide or LY3437943. Papers describe retatrutide as one peptide acting at three receptors: GIP, GLP-1 and glucagon. Source sentence"GLP-3"[tiab] AND (retatrutide[tiab] OR "LY3437943"[tiab]): 0 records; GLP-3 AND retatrutide: 0 records. PMID 42810372: "Retatrutide is an agonist of GIP, GLP-1, and glucagon receptors"21 PubMed search for GLP-3 with retatrutide, 14 October 20261 Lancet 2026, TRIUMPH-2

Which receptors does retatrutide act at?

At the receptor level, retatrutide is an agonist at the glucagon, GIP and GLP-1 receptors. The studies on this page measured receptor signalling in cells and isolated mouse heart tissue, kidney, liver and brain markers in rodents, and prespecified endpoints in randomised human trials; the page lists what each study measured, not its results. Source sentenceAbstract: "LY3437943 is a novel triple agonist peptide at the glucagon receptor (GCGR), glucose-dependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R)."5 Cell Metab 202222 Naunyn Schmiedebergs Arch Pharmacol 202523 iScience 202624 Am J Physiol Gastrointest Liver Physiol 202525 Behav Brain Res 202626 N Engl J Med 20238 N Engl J Med 2026, TRIUMPH-1

What clinical trials of retatrutide exist?

ClinicalTrials.gov listed 33 records for retatrutide on 14 Oct 2026: 14 phase 1, 4 phase 2 and 14 phase 3 studies, plus one expanded access record. Of the 14 phase 3 studies, 5 are completed, 8 are active but not recruiting and 1 is recruiting. Three phase 3 trials have journal papers (PMID 42814954, 42810372 and 42250575), and in each the primary endpoints were met. Source sentencequery.intr retatrutide: totalCount 33; phases PHASE1 14, PHASE2 4, PHASE3 14, one expanded access record (status AVAILABLE, no phase); phase 3 overall status COMPLETED 5, ACTIVE_NOT_RECRUITING 8, RECRUITING 1; lead sponsor Eli Lilly and Company 32, Hudson Biotech 17 ClinicalTrials.gov search, 14 October 20268 N Engl J Med 2026, TRIUMPH-11 Lancet 2026, TRIUMPH-29 Lancet 2026, NCT06354660

When will retatrutide be available? What the records show

No record checked for this page gives a date. Eli Lilly and Company's release of 12 Aug 2026 describes retatrutide as investigational, states that no medicine containing it has been approved by any regulatory agency, and gives no date for a marketing application. On 14 Oct 2026, ClinicalTrials.gov listed 9 phase 3 retatrutide studies as active or recruiting, with estimated completion dates from Nov 2026 to Aug 2032. Source sentenceRetatrutide is an investigational molecule in Phase 3 clinical trials ... No medicine containing retatrutide has yet been approved for human use by any regulatory agency in the world. Full release read on 14 Oct 2026: no filing or submission date is stated. ClinicalTrials.gov: phase 3 ACTIVE_NOT_RECRUITING 8 and RECRUITING 1, completion dates 2026-11 (NCT06297603) to 2032-08 (NCT07165028), estimated4 Eli Lilly and Company news release, 12 August 20267 ClinicalTrials.gov search, 14 October 202627 NCT0629760328 NCT07165028

Is retatrutide approved in the EU or the UK?

No EU authorisation was found: EMA medicines and orphan designation data held no retatrutide record on 14 Oct 2026. For the United Kingdom, the MHRA stated on 24 Jul 2026 that retatrutide "has not been authorised for use in the UK". France's ANSM names retatrutide among products offered without authorisation in its alert of 2 Jul 2026. Source sentenceEMA: 0 of 2748 medicine records and 0 of 3310 orphan designation records match retatrutide or LY3437943. MHRA, 24 Jul 2026: "It has not been authorised for use in the UK". ANSM: "Parmi les produits proposés sans autorisation des autorités sanitaires, on trouve par exemple le rétatrutide"29 EMA medicines and orphan designation data, 14 October 202630 GOV.UK search for retatrutide, 14 October 202631 ANSM, 2 July 2026, updated 31 August 2026

Evidence map: retatrutide

Primary studies of retatrutide (LY3437943), by model and by what was measured. Reviews are not counted. An empty cell means: not mapped yet.
ModelChemistry and analyticalPharmacokineticsReceptor binding and signallingTissue histologyBiomarkersClinical endpoint
Analytical only (no biological model)Chemistry and analytical2Pharmacokinetics1Not mapped yetNot mapped yetNot mapped yetNot mapped yet
In vitro or ex vivoNot mapped yetNot mapped yetReceptor binding and signalling3Not mapped yetNot mapped yetNot mapped yet
RodentNot mapped yetNot mapped yetNot mapped yetTissue histology4Biomarkers4Not mapped yet
Other animalNot mapped yetNot mapped yetNot mapped yetNot mapped yetNot mapped yetNot mapped yetNot mapped yet
Human, uncontrolledNot mapped yetNot mapped yetNot mapped yetNot mapped yetNot mapped yetNot mapped yetNot mapped yet
Human, randomisedNot mapped yetPharmacokinetics1Not mapped yetNot mapped yetBiomarkers4Clinical endpoint3

15 studies countedEvidence level facet: L4. A design scale, not a measure of strength or quality.

Counts only the exact match studies reviewed for this page on 14 October 2026, out of 201 PubMed records found for retatrutide or LY3437943, 119 of them reviews. Empty cells are not mapped yet. Reviews are never counted, and each human trial is counted by what it measured, not by its result.

Who produced this evidence

  • Eli Lilly and Company is lead sponsor of 32 of the 33 ClinicalTrials.gov records for retatrutide; the other, a phase 2 study in China (NCT07467447, recruiting), lists Hudson Biotech as lead sponsor. Source sentencequery.intr retatrutide: totalCount 33; phases PHASE1 14, PHASE2 4, PHASE3 14, one expanded access record (status AVAILABLE, no phase); phase 3 overall status COMPLETED 5, ACTIVE_NOT_RECRUITING 8, RECRUITING 1; lead sponsor Eli Lilly and Company 32, Hudson Biotech 1; NCT07467447: lead sponsor Hudson Biotech, Phase 2, RECRUITING, location China7 ClinicalTrials.gov search, 14 October 202636 NCT07467447
  • All authors of the 2022 discovery paper are Lilly employees and stockholders, the Lilly authors of the 2022 phase 1b paper declare employment and shareholdings, and the 2023 Lancet and NEJM phase 2 papers and the three phase 3 papers state Eli Lilly funding. Source sentence35985340 COI: "All authors are employees and stockholders of Eli Lilly and Company"; 36354040 COI: "SU, TC, MTL, YD, SG, AH, CTB, and ZM are employees and shareholders of Eli Lilly and Company"; 37385280 and 42250575: "FUNDING: Eli Lilly and Company"; 37366315: "Funded by Eli Lilly"; 42814954: "Funded by Eli Lilly"; 42810372: funding Eli Lilly and Company5 Cell Metab 202232 Lancet 202233 Lancet 202326 N Engl J Med 20239 Lancet 2026, NCT063546608 N Engl J Med 2026, TRIUMPH-11 Lancet 2026, TRIUMPH-2
  • The cell, animal and analytical studies on this page come from academic groups in Halle (Germany), Wuhan and Huai'an (China), Kütahya (Türkiye), San Diego (United States), Rio de Janeiro (the LADETEC laboratory, Brazil) and Brisbane (Australia); five of these papers declare no competing interests. Source sentenceAffiliations: Martin-Luther-University Halle-Wittenberg (40464942); South-Central Minzu University, Wuhan (42630988); Xuzhou Medical University, Huai'an (39212900); Kütahya Health Sciences University (42385950); University of California San Diego (41056349); LADETEC, Universidade Federal do Rio de Janeiro (42745421); University of Queensland, Brisbane (42559975). COI "no conflicts" or "no competing interests": 42745421, 42559975, 42630988, 39212900, 4238595022 Naunyn Schmiedebergs Arch Pharmacol 202523 iScience 202635 Endocrine 202525 Behav Brain Res 202624 Am J Physiol Gastrointest Liver Physiol 202520 Rapid Commun Mass Spectrom 202614 Drug Alcohol Rev 2026

Studies

  1. In vitro or ex vivoCell Metab 2022

    Activity at the glucagon, GIP and GLP-1 receptors in vitro, metabolic measures in mice, and safety, tolerability and pharmacokinetics in a phase 1 study

    Design
    Receptor assays in vitro, mouse studies and a phase 1 study
    Population or model
    receptor assays in vitro, mice, and a phase 1 study
    Molecule
    retatrutide (LY3437943) exact
    Funding
    Eli Lilly and Company

    All authors declare employment and stock at Eli Lilly and Company (COI statement).

    PubMed 35985340DOI

  2. Human, randomisedLancet 2022

    Safety and tolerability (primary), pharmacokinetics and glycaemic measures

    Design
    Phase 1b, randomised, double-blind, placebo-controlled, multiple ascending cohorts, with a dulaglutide arm
    Population or model
    adults with HbA1c of 7.0 to 10.5 percent, four US centres
    Molecule
    retatrutide (LY3437943) exact
    n
    72
    Comparator
    placebo; dulaglutide
    Blinding
    double-blind
    Duration
    12 weeks
    Funding
    Eli Lilly and Company

    Lilly authors declare employment and shareholdings (COI statement).

    PubMed 36354040DOI

  3. Human, randomisedLancet 2023

    Change in HbA1c from baseline to 24 weeks (primary) and adverse events

    Design
    Phase 2, randomised, double-blind, double-dummy, placebo- and active comparator-controlled, parallel-group
    Population or model
    adults with HbA1c of 7.0 to 10.5 percent, 42 US centres
    Molecule
    retatrutide (LY3437943) exact
    n
    281
    Comparator
    placebo; dulaglutide
    Blinding
    double-blind
    Duration
    36 weeks
    Funding
    Eli Lilly and Company

    Authors report grants, consulting or speaker fees from Eli Lilly and Company and other companies (COI statement).

    PubMed 37385280DOI

  4. Human, randomisedN Engl J Med 2023

    The primary endpoint at 24 weeks as registered (NCT04881760), secondary endpoints at 48 weeks, adverse events and heart rate

    Design
    Phase 2, randomised, double-blind, placebo-controlled
    Population or model
    adults, registry NCT04881760
    Molecule
    retatrutide (LY3437943) exact
    n
    338
    Comparator
    placebo
    Blinding
    double-blind
    Duration
    48 weeks
    Funding
    Eli Lilly and Company

    PubMed 37366315DOI

  5. Human, randomisedNat Med 2024

    Relative change in liver steatosis from baseline at 24 weeks (primary)

    Design
    Phase 2a substudy, randomised, double-blind, placebo-controlled
    Population or model
    participants with metabolic dysfunction-associated steatotic liver disease from the phase 2 trial NCT04881760
    Molecule
    retatrutide (LY3437943) exact
    n
    98
    Comparator
    placebo
    Blinding
    double-blind
    Duration
    48 weeks

    Authors report consulting or advisory ties to Eli Lilly and Company and other companies (COI statement).

    PubMed 38858523DOI

  6. Human, randomisedLancet 2026

    Change in HbA1c from baseline to week 40 (primary) and adverse events

    Design
    Phase 3, randomised, double-blind, placebo-controlled
    Population or model
    adults with HbA1c of 7.0 to 9.5 percent on diet and exercise alone, 48 sites in the USA, Mexico and India
    Molecule
    retatrutide (LY3437943) exact
    n
    537
    Comparator
    placebo
    Blinding
    double-blind
    Duration
    40 weeks
    Funding
    Eli Lilly and Company

    Authors report research support, speaker fees or stock tied to Eli Lilly and Company and other companies (COI statement).

    PubMed 42250575DOI

  7. Human, randomisedN Engl J Med 2026

    The primary endpoints as registered (NCT05929066)

    Design
    Phase 3, randomised, double-blind, placebo-controlled (TRIUMPH-1)
    Population or model
    adults, with knee osteoarthritis and obstructive sleep apnea subsets
    Molecule
    retatrutide (LY3437943) exact
    n
    2339
    Comparator
    placebo
    Blinding
    double-blind
    Duration
    80 weeks
    Funding
    Eli Lilly and Company

    n is the number randomised in the abstract; the registry lists 2,335 enrolled.

    PubMed 42814954DOI

  8. Human, randomisedLancet 2026

    The primary endpoint at week 80 as registered (NCT05929079), glycaemic measures and adverse events

    Design
    Phase 3, randomised, double-blind, placebo-controlled, parallel-group (TRIUMPH-2)
    Population or model
    adults with HbA1c of 6.5 to 10.5 percent, 92 centres in eight countries
    Molecule
    retatrutide (LY3437943) exact
    n
    1152
    Comparator
    placebo
    Blinding
    double-blind
    Duration
    80 weeks
    Funding
    Eli Lilly and Company

    Authors report consulting, speaker or research ties to Eli Lilly and Company and other companies (COI statement).

    PubMed 42810372DOI

  9. Analytical only (no biological model)Rapid Commun Mass Spectrom 2026

    LC-HRMS detection of intact retatrutide in plasma and urine, limits of detection and the plasma time course

    Design
    LC-HRMS method development and validation to WADA criteria, with plasma and urine time courses
    Population or model
    human plasma and urine samples from 4 individuals
    Molecule
    retatrutide (LY3437943) exact
    n
    4

    The authors declare no conflicts of interest.

    PubMed 42745421DOI

  10. Analytical only (no biological model)Drug Alcohol Rev 2026

    Identity by molecular mass and peptide content per vial

    Design
    Laboratory analysis of products (letter)
    Population or model
    three products sold as retatrutide in Australia
    Molecule
    retatrutide (LY3437943) exact
    n
    3

    The authors declare no conflicts of interest.

    PubMed 42559975DOI

  11. In vitro or ex vivoNaunyn Schmiedebergs Arch Pharmacol 2025

    Force of contraction and beating rate, with a glucagon receptor antagonist and a protein kinase A inhibitor

    Design
    Isolated organ pharmacology
    Population or model
    isolated left and right atrial preparations from adult CD1 mice
    Molecule
    retatrutide (LY3437943) exact
    Comparator
    isoprenaline; receptor antagonists and pathway inhibitors

    PubMed 40464942DOI

  12. RodentiScience 2026

    Renal fibrosis and inflammation markers, PI3K-AKT and NF-kB pathway activity, and G2/M arrest in the aging model

    Design
    Cell and mouse comparison with semaglutide and tirzepatide
    Population or model
    HK-2 kidney cells; mouse unilateral ureteral obstruction (UUO) and aging models
    Molecule
    retatrutide (LY3437943) exact
    Comparator
    semaglutide; tirzepatide

    The authors declare no competing interests.

    PubMed 42630988DOI

  13. RodentEndocrine 2024

    Blood glucose, serum biochemistry, renal inflammation and fibrosis markers, and intestinal butyrate

    Design
    Mouse comparison with liraglutide and tirzepatide
    Population or model
    db/db mice, 10 weeks
    Molecule
    retatrutide (LY3437943) exact
    Comparator
    liraglutide; tirzepatide
    Duration
    10 weeks

    The authors declare no competing interests.

    PubMed 39212900DOI

  14. RodentBehav Brain Res 2026

    Learning and memory tasks, hippocampal cytokines, BDNF, CREB and AKT expression, Tau protein and brain histology

    Design
    Controlled rat study with four groups
    Population or model
    male Sprague-Dawley rats, streptozotocin-induced insulin-deficient model
    Molecule
    retatrutide (LY3437943) exact
    Comparator
    control, streptozotocin-only and retatrutide-only groups

    The authors declare no competing interests.

    PubMed 42385950DOI

  15. RodentAm J Physiol Gastrointest Liver Physiol 2025

    ALT, hepatic triglycerides and cholesterol, hepatic inflammatory markers and liver gene expression

    Design
    Mouse model development plus a vehicle-controlled intervention
    Population or model
    C57BL/6N mice, 31-day diet-induced steatohepatitis model
    Molecule
    retatrutide (LY3437943) exact
    Comparator
    vehicle
    Duration
    2 weeks of a 31-day model

    PubMed 41056349DOI

Receptors and signalling studied

  • A 2022 discovery paper describes LY3437943 as an agonist at the glucagon, GIP and GLP-1 receptors and measured its activity at each of the three receptors in vitro. Source sentenceAbstract: "LY3437943 is a novel triple agonist peptide at the glucagon receptor (GCGR), glucose-dependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R)." The abstract then reports in vitro activity at GCGR, GLP-1R and GIPR5 Cell Metab 2022
  • A 2025 study in isolated mouse atrial preparations measured beating rate and force of contraction, and used a glucagon receptor antagonist and a protein kinase A inhibitor to test which receptor and pathway were involved. Source sentenceAbstract: preparations "from adult CD1 mice"; "antagonized by adomeglivant, a GCGR antagonist"; "attenuated by H89, an inhibitor of the cAMP-dependent protein kinase (PKA)"22 Naunyn Schmiedebergs Arch Pharmacol 2025
  • A 2026 study measured renal fibrosis and inflammation markers and PI3K-AKT and NF-kB pathway activity in HK-2 kidney cells and in mouse UUO and aging models, alongside semaglutide and tirzepatide. Source sentenceAbstract: "... renal fibrosis using HK-2 cells and murine UUO and aging models"; the abstract reports PI3K-AKT and NF-κB pathway measures for each agent23 iScience 2026
  • A 2025 study in db/db mice measured blood glucose, serum biochemistry, renal inflammation and fibrosis markers and intestinal butyrate, alongside liraglutide and tirzepatide. Source sentenceAbstract, Methods: "we measured and compared the renal inflammation and fibrosis indexes"; "the content of intestinal metabolite butyrate was compared"35 Endocrine 2025
  • A 2026 study in a streptozotocin-induced, insulin-deficient rat model measured learning and memory tasks, hippocampal cytokines, BDNF, CREB and AKT expression, Tau protein and brain histology. Source sentenceAbstract: "hippocampal cytokine levels (IL-1β, TNF-α), BDNF, CREB, and AKT mRNA expression, Tau protein levels, and cortical and hippocampal histopathology were evaluated"25 Behav Brain Res 2026
  • A 2025 study in a 31-day diet-induced mouse model of steatohepatitis measured ALT, hepatic triglycerides and cholesterol, hepatic inflammatory markers and liver gene expression. Source sentenceAbstract: "a new 31-day mouse model of diet-induced steatohepatitis"; measures "ALT levels, hepatic triglycerides and cholesterol, and hepatic inflammatory markers"; "hepatic gene expression profile per RNA sequencing"24 Am J Physiol Gastrointest Liver Physiol 2025

Status matrix

European Union: medicines records and the ANSM alert

EU

  • No EU authorised medicine or orphan designation for retatrutide or LY3437943 was found in EMA data on 14 Oct 2026. Source sentence0 of 2748 medicine records (timestamp 2026-10-14) and 0 of 3310 orphan designation records match retatrutide or LY343794329 EMA medicines and orphan designation data, 14 October 2026
  • France's medicines agency ANSM names retatrutide among products offered without authorisation in its alert on peptides sold online (published 2 Jul 2026, updated 31 Aug 2026). Source sentencePUBLIÉ LE 02/07/2026 - MIS À JOUR LE 31/08/2026 ... "Parmi les produits proposés sans autorisation des autorités sanitaires, on trouve par exemple le rétatrutide, le BP180, le TB500"31 ANSM, 2 July 2026, updated 31 August 2026
  • The ANSM update of 31 Aug 2026 reports a new police sanitaire measure against a product presented as containing retatrutide. Source sentence"Actualisation du 31/08/2026 Nouvelle mesure de police sanitaire contre la vente illicite de produits présentés comme des aGLP-1 sur internet. Est concerné le produit ... présenté comme contenant du retatrutide."31 ANSM, 2 July 2026, updated 31 August 2026

United Kingdom: MHRA statements and enforcement

UK

  • The MHRA stated on 24 Jul 2026 that retatrutide "has not been authorised for use in the UK, meaning anyone selling this product is doing so illegally". Source sentenceMHRA news story, 24 Jul 2026 (GOV.UK content API): "It has not been authorised for use in the UK, meaning anyone selling this product is doing so illegally."30 GOV.UK search for retatrutide, 14 October 2026
  • An MHRA release of 24 Oct 2025 describes retatrutide as a medicine in clinical development "which has not been approved for UK use" and states that, outside authorised clinical trials, products sold in the UK that claim to contain it "are likely to be illegal". Source sentenceMHRA news story, 24 Oct 2025: "Retatrutide is GLP-1 medicine in clinical development, which has not been approved for UK use." "Outside of authorised clinical trials, any products being sold in the UK that claim to contain retatrutide are likely to be illegal"30 GOV.UK search for retatrutide, 14 October 2026
  • MHRA enforcement releases name retatrutide: a seizure of more than 2,000 unlicensed retatrutide and tirzepatide products (24 Oct 2025), and two premises searches, in Lincolnshire (25 Feb 2026) and on 29 May 2026, of sites it describes as used for unlicensed medicines including retatrutide. Source sentence24 Oct 2025: "more than 2,000 unlicensed retatrutide and tirzepatide pens awaiting dispatch to customers"; 25 Feb 2026: premises "a farm near Sleaford and a residential address in Grantham" ... "including retatrutide and tirzepatide"; 29 May 2026: "including retatrutide and tirzepatide, as well as peptide products"30 GOV.UK search for retatrutide, 14 October 2026

Sport anti-doping list

International

  • The WADA 2026 Prohibited List does not name retatrutide or LY3437943 (text search of the list on 14 Oct 2026). Source sentenceNo match for retatrutide, LY3437943, glucagon or GLP in the full text of the 2026 list37 WADA Prohibited List 2026
  • The list's class S0 covers pharmacological substances not addressed elsewhere on the list and without current approval by any government health regulator for use in humans. Source sentence"Any pharmacological substance which is not addressed by any of the subsequent sections of the List and with no current approval by any governmental regulatory health authority for human therapeutic use (e.g. drugs under pre-clinical or clinical development ...) is prohibited at all times."37 WADA Prohibited List 2026
  • A 2026 paper from the LADETEC laboratory in Rio de Janeiro validated an LC-HRMS method for retatrutide in plasma and urine against WADA criteria and measured both sample types over time. Source sentenceAbstract, Methods: "A method based on liquid chromatography-high-resolution mass spectrometry (LC-HRMS) dedicated to monitor retatrutide was developed and validated in human plasma and urine in accordance with World Anti-Doping Agency (WADA) criteria." Blood and urine samples were collected at predefined time points20 Rapid Commun Mass Spectrom 2026

Safety alerts outside trials

  • , Victoria Department of Health (Australia) (Australia), alert: These toxic effects are possibly associated with a contaminant in the products labelled as ‘Retatrutide’ and all such products are at risk. TGA: laboratory test of one product sold as retatrutide, safety advisory of 14 Sep 2026 38 Victoria Department of Health alert, 19 June 2026
  • , Medsafe (New Zealand) (New Zealand), advisory: Retatrutide is a potential medicine that is still being studied. It has not been approved for use by any trusted medicines regulator, apart from use in overseas clinical trials. Victoria Department of Health: alert of 19 Jun 2026 on products labelled Retatrutide 39 Medsafe consumer advisory, 21 May 2026

Registered trials

  • NCT05929066Phase 3

    Status
    TRIUMPH-1. Completed 30 Apr 2026; no results posted on the registry
    Sponsor
    Eli Lilly and Company
    Site countries
    Australia, Brazil, Canada, Hungary, India, Mexico, Poland, Puerto Rico, Romania, Spain, UK, US
    Primary endpoint
    Primary endpoints as registered
    Primary endpoint met
    met
    Last synced
    14 October 2026

  • NCT05929079Phase 3

    Status
    TRIUMPH-2. Completed 16 Jun 2026; no results posted on the registry
    Sponsor
    Eli Lilly and Company
    Site countries
    Argentina, Australia, Brazil, India, Mexico, Romania, Spain, US
    Primary endpoint
    Primary endpoint at week 80, as published
    Primary endpoint met
    met
    Last synced
    14 October 2026

  • NCT05882045Phase 3

    Status
    TRIUMPH-3. Completed 14 May 2026; no results posted, no paper found as of 14 Oct 2026
    Sponsor
    Eli Lilly and Company
    Site countries
    Argentina, Australia, Canada, Hungary, Mexico, Poland, Puerto Rico, Slovakia, Spain, US
    Primary endpoint
    One primary endpoint at week 80, as registered
    Primary endpoint met
    not reported
    Last synced
    14 October 2026

  • NCT06297603Phase 3

    Status
    TRANSCEND-T2D-3. Active, not recruiting; completion estimated Nov 2026
    Sponsor
    Eli Lilly and Company
    Site countries
    Argentina, Brazil, Israel, Mexico, Puerto Rico, UK, US
    Primary endpoint
    Change in HbA1c from baseline to week 52
    Primary endpoint met
    not reported
    Last synced
    14 October 2026

  • NCT06383390Phase 3

    Status
    TRIUMPH-Outcomes. Active, not recruiting; completion estimated Feb 2029
    Sponsor
    Eli Lilly and Company
    Site countries
    Argentina, Australia, Austria, Belgium, Brazil, Canada, Czechia, Denmark, France, Germany, Greece, Hungary, India, Israel, Italy, Mexico, Netherlands, New Zealand, Poland, Puerto Rico, Romania, Slovakia, Spain, Türkiye, Ukraine, UK, US
    Primary endpoint
    Time to first composite cardiovascular event, and a composite kidney endpoint
    Primary endpoint met
    not reported
    Last synced
    14 October 2026

  • NCT06662383Phase 3

    Status
    TRIUMPH-5. Active, not recruiting; primary completion estimated Nov 2026
    Sponsor
    Eli Lilly and Company
    Site countries
    Argentina, Germany, Poland, Puerto Rico, US
    Primary endpoint
    One primary endpoint at week 80, compared with tirzepatide, as registered
    Primary endpoint met
    not reported
    Last synced
    14 October 2026

  • NCT06859268Phase 3

    Status
    TRIUMPH-6. Active, not recruiting; completion estimated Apr 2028
    Sponsor
    Eli Lilly and Company
    Site countries
    Canada, UK, US
    Primary endpoint
    One primary endpoint at week 116, as registered
    Primary endpoint met
    not reported
    Last synced
    14 October 2026

  • NCT07035093Phase 3

    Status
    TRIUMPH-7. Active, not recruiting; completion estimated Sep 2027
    Sponsor
    Eli Lilly and Company
    Site countries
    Argentina, Canada, Poland, US
    Primary endpoint
    Pain intensity on a numeric rating scale (chronic low back pain) and a second primary endpoint, as registered
    Primary endpoint met
    not reported
    Last synced
    14 October 2026

  • NCT07232719Phase 3

    Status
    TRIUMPH-8. Active, not recruiting; completion estimated Jul 2027
    Sponsor
    Eli Lilly and Company
    Site countries
    UK, US
    Primary endpoint
    One primary endpoint at week 56, as registered
    Primary endpoint met
    not reported
    Last synced
    14 October 2026

  • NCT05936151Phase 2

    Status
    Completed 21 Oct 2025; no results posted on the registry
    Sponsor
    Eli Lilly and Company
    Site countries
    Canada, Italy, Spain, UK, US
    Primary endpoint
    Change in measured glomerular filtration rate at week 24
    Primary endpoint met
    not reported
    Last synced
    14 October 2026

  • NCT07467447Phase 2

    Status
    Recruiting; completion estimated Feb 2028
    Sponsor
    Hudson Biotech
    Site countries
    China (global context)
    Primary endpoint
    One primary endpoint at week 24, as registered
    Primary endpoint met
    not reported
    Last synced
    14 October 2026
  • ClinicalTrials.gov on 14 Oct 2026: 33 records for retatrutide (14 phase 1, 4 phase 2, 14 phase 3, one expanded access record). The table lists 16 of the 18 phase 2 and phase 3 records; the other two are NCT05931367 (TRIUMPH-4, completed) and NCT07165028 (recruiting). Phase 1 records are not listed. Source sentencequery.intr retatrutide: totalCount 33; phases PHASE1 14, PHASE2 4, PHASE3 14, one expanded access record (status AVAILABLE, no phase); phase 3 overall status COMPLETED 5, ACTIVE_NOT_RECRUITING 8, RECRUITING 1; lead sponsor Eli Lilly and Company 32, Hudson Biotech 17 ClinicalTrials.gov search, 14 October 202611 NCT0593136728 NCT07165028
  • Results are posted on ClinicalTrials.gov for two of the listed studies, both phase 2 (NCT04881760 and NCT04867785). Source sentencehasResults true: NCT04881760, NCT04867785; hasResults false for every phase 3 record7 ClinicalTrials.gov search, 14 October 202646 NCT0488176047 NCT04867785
  • Two phase 2 rows derive their state from the results posted on the registry: NCT04881760 is marked met and NCT04867785 is marked mixed, from the six primary comparisons each record posts. Source sentenceRegistry results section of each record, primary outcome statistical analyses, six comparisons per study, read 14 Oct 2026: NCT04881760 met in all six; NCT04867785 met in five of six and not met in one47 NCT0486778546 NCT04881760

Timeline

  1. Discovery paper describes LY3437943 as a triple agonist at the glucagon, GIP and GLP-1 receptors Source sentenceCell Metab, published online 18 Aug 20225 Cell Metab 2022
  2. Phase 1b randomised trial (NCT04143802) published Source sentenceLancet, published online 27 Oct 2022; "phase 1b, proof-of-concept, double-blind, placebo-controlled, randomised"32 Lancet 2022
  3. Phase 2 randomised trials published in NEJM and The Lancet Source sentenceN Engl J Med and Lancet, both published online 26 Jun 202326 N Engl J Med 202333 Lancet 2023
  4. TRIUMPH-1 phase 3 trial starts Source sentenceStudy start 2023-07-10 (ACTUAL)40 NCT05929066
  5. Phase 2a substudy in metabolic dysfunction-associated steatotic liver disease published Source sentenceNat Med, published online 10 Jun 202434 Nat Med 2024
  6. Phase 3 trial NCT06354660 published in The Lancet Source sentenceLancet, published online 6 Jun 2026; registered NCT063546609 Lancet 2026, NCT06354660
  7. Letter reports laboratory tests of three products sold as retatrutide in Australia Source sentenceDrug Alcohol Rev 2026 Sep;45(6):e70231 (PubMed publication date 2026 Sep)14 Drug Alcohol Rev 2026
  8. TGA laboratory finds semaglutide and no retatrutide in one product sold as retatrutide Source sentencePublished 14 September 202616 TGA safety advisory, 14 September 2026
  9. TRIUMPH-1 and TRIUMPH-2 phase 3 papers published Source sentenceN Engl J Med, 29 Sep 2026 (TRIUMPH-1); Lancet, published online 29 Sep 2026 (TRIUMPH-2)8 N Engl J Med 2026, TRIUMPH-11 Lancet 2026, TRIUMPH-2

Integrity notes

  • PubMed CommentsCorrections was checked on 14 Oct 2026 for the studies on this page, and PubMed holds no retatrutide record typed as a retracted publication, expression of concern or published erratum. Source sentenceCommentsCorrections: no Retraction, Erratum or ExpressionOfConcern entries for the 15 studies; (retatrutide[tiab] OR "LY3437943"[tiab]) AND (retracted publication[pt] OR expression of concern[pt] OR published erratum[pt]): 0 records6 PubMed search for retatrutide and LY3437943, 14 October 2026
  • PubMed links published comments to three trial papers: three to the 2023 NEJM phase 2 paper and one each to the 2023 Lancet phase 2 paper and the 2022 phase 1b paper. Source sentenceCommentIn: 37888925, 37888926, 37888927 (37366315); 37385276 (37385280); 36436519 (36354040)26 N Engl J Med 202333 Lancet 202332 Lancet 2022
  • TRIUMPH-1 counts differ by source: ClinicalTrials.gov gives an actual enrollment of 2,335, while the NEJM abstract reports 2,339 participants randomised. Source sentenceNCT05929066 enrollmentInfo: count 2335, type ACTUAL. PMID 42814954, Results: "A total of 2339 participants underwent randomization."40 NCT059290668 N Engl J Med 2026, TRIUMPH-1
  • A 2026 post hoc analysis of the two phase 2 trials (NCT04881760 and NCT04867785) measured lipoprotein and inflammatory biomarkers; its authors include Lilly employees. Source sentenceAbstract, Aims: "lipoprotein and inflammatory biomarkers were assessed post hoc in phase 2 trials"; trial registration NCT04881760 and NCT04867785; COI: authors "are (or were at the time this research was conducted) employees and shareholders of Eli Lilly and Company"48 Ruotolo et al. 2026

Chemistry and records

Retatrutide: sequence, mass, CAS and regulatory record in the research library →

Sources

  1. 1Lancet 2026, TRIUMPH-2 accessed 14 Oct 2026
  2. 2GSRS substance record, UNII NOP2Y096GV accessed 14 Oct 2026
  3. 3PubChem CID 171390338 accessed 14 Oct 2026
  4. 4Eli Lilly and Company news release, 12 August 2026 accessed 14 Oct 2026
  5. 5Cell Metab 2022 accessed 14 Oct 2026
  6. 6PubMed search for retatrutide and LY3437943, 14 October 2026 accessed 14 Oct 2026
  7. 7ClinicalTrials.gov search, 14 October 2026 accessed 14 Oct 2026
  8. 8N Engl J Med 2026, TRIUMPH-1 accessed 14 Oct 2026
  9. 9Lancet 2026, NCT06354660 accessed 14 Oct 2026
  10. 10NCT05882045 accessed 14 Oct 2026
  11. 11NCT05931367 accessed 14 Oct 2026
  12. 12NCT06662383 accessed 14 Oct 2026
  13. 13NCT06383390 accessed 14 Oct 2026
  14. 14Drug Alcohol Rev 2026 accessed 14 Oct 2026
  15. 15PMC full text of the 2026 letter (PMID 42559975) accessed 14 Oct 2026
  16. 16TGA safety advisory, 14 September 2026 accessed 14 Oct 2026
  17. 17Peptency catalog chemistry record, retatrutide accessed 14 Oct 2026
  18. 18GSRS name search for retatrutide, 14 October 2026 accessed 14 Oct 2026
  19. 19PubChem CID 56843331 accessed 14 Oct 2026
  20. 20Rapid Commun Mass Spectrom 2026 accessed 14 Oct 2026
  21. 21PubMed search for GLP-3 with retatrutide, 14 October 2026 accessed 14 Oct 2026
  22. 22Naunyn Schmiedebergs Arch Pharmacol 2025 accessed 14 Oct 2026
  23. 23iScience 2026 accessed 14 Oct 2026
  24. 24Am J Physiol Gastrointest Liver Physiol 2025 accessed 14 Oct 2026
  25. 25Behav Brain Res 2026 accessed 14 Oct 2026
  26. 26N Engl J Med 2023 accessed 14 Oct 2026
  27. 27NCT06297603 accessed 14 Oct 2026
  28. 28NCT07165028 accessed 14 Oct 2026
  29. 29EMA medicines and orphan designation data, 14 October 2026 accessed 14 Oct 2026
  30. 30GOV.UK search for retatrutide, 14 October 2026 accessed 14 Oct 2026
  31. 31ANSM, 2 July 2026, updated 31 August 2026 accessed 14 Oct 2026
  32. 32Lancet 2022 accessed 14 Oct 2026
  33. 33Lancet 2023 accessed 14 Oct 2026
  34. 34Nat Med 2024 accessed 14 Oct 2026
  35. 35Endocrine 2025 accessed 14 Oct 2026
  36. 36NCT07467447 accessed 14 Oct 2026
  37. 37WADA Prohibited List 2026 accessed 14 Oct 2026
  38. 38Victoria Department of Health alert, 19 June 2026 accessed 14 Oct 2026
  39. 39Medsafe consumer advisory, 21 May 2026 accessed 14 Oct 2026
  40. 40NCT05929066 accessed 14 Oct 2026
  41. 41NCT05929079 accessed 14 Oct 2026
  42. 42NCT06859268 accessed 14 Oct 2026
  43. 43NCT07035093 accessed 14 Oct 2026
  44. 44NCT07232719 accessed 14 Oct 2026
  45. 45NCT05936151 accessed 14 Oct 2026
  46. 46NCT04881760 accessed 14 Oct 2026
  47. 47NCT04867785 accessed 14 Oct 2026
  48. 48Ruotolo et al. 2026 accessed 14 Oct 2026

About this page

Research-use information. This library summarises published literature and regulator records. It is not guidance for use, not medical advice, and not a statement that any material is suitable for use in people or animals.

Reviewed by the Peptency editorial process. Version 1, last edited 14 October 2026, 48 sources.

Cite this page: Peptency Academy. Retatrutide (LY3437943): chemistry, trials and regulator records. Version 1./eu/academy/compounds/retatrutide/